SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI3243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI3243
Domain Number 1 Region: 101-173
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.18e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000057
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI3243
Sequence length 210
Comment (Nematostella vectensis)
Sequence
KKSMNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEDPVFVVTGRKEDV
TLAKREIISAAEHFSQIRAQRKNNSLNSLAPGPPSPSVPGQSTILVRVPYRVVGLVVGPK
GATIKRIQQQTNTYIVTPSRDKEPVFEVTGSGENVESARNEILNHISNRTGGLLDANDDS
VFHNGDLNSFNDFRPGSIYSSGSQSGFSSL
Download sequence
Identical sequences A7SV60
XP_001624514.1.94760 jgi|Nemve1|3243|gw.320.9.1 45351.JGI3243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]