SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI57118 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI57118
Domain Number 1 Region: 49-107
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000667
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000123
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI57118
Sequence length 107
Comment (Nematostella vectensis)
Sequence
YGLWSLWGSCSKLCGTGTQLRTRICHSRKSCVGPSTQVRHCNPQPCPSTLNGGYSPWGAW
SGCDADCGGGVRERTRFCTNPVPGWGGRHCEALGPSKVSELCNLAPC
Download sequence
Identical sequences A7S4R9
XP_001633433.1.94760 jgi|Nemve1|57118|gw.73.208.1 45351.JGI57118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]