SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI7031 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI7031
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.58e-64
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI7031
Sequence length 186
Comment (Nematostella vectensis)
Sequence
PENKIKNRYGNIVTYDHTRVVLKGPGGNRDGRSDYINASYLQGFDGTPKKYIAAQGPVEP
SCDDFWQMVWQERCSVIVMLTGLIEGNKEKCHKYWPDTNQPKPYGQYTVSLCKNEAFADY
TVRTFLVTVRLQQQRVGDEGLRFIYQYHFTVWPDKGVPQYATAVLRFRKKIINESRHNTA
PWIVHC
Download sequence
Identical sequences A7TCF9
jgi|Nemve1|7031|gw.7716.2.1 45351.JGI7031 XP_001618373.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]