SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI87375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI87375
Domain Number 1 Region: 77-223
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.41e-21
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 205-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000343
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 3 Region: 1-80
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000424
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI87375
Sequence length 257
Comment (Nematostella vectensis)
Sequence
CQQICSNIPGSYACGCYKGYQKNPNYHSKCDDFDECAMSPCRCANQNNFGCNATCINTAG
SFVCKCSKGYTLIRGTICQDINECERNNGWCEHDCINILGTYRCRCRDGYKLDPNRRTCQ
DLDECALFNGCEAICNNTQGSYHCACLNGYQLNSDGLTCSDLDECSIQHVSGLRGNASLA
DCEQVCVNVIGSFTCACKRGFILRHDGKTCEDIDECDTGLHKCEHQCNNTFGSYSCSCSP
GFALADDKKSCKGTETP
Download sequence
Identical sequences A7RN00
XP_001639249.1.94760 jgi|Nemve1|87375|e_gw.15.55.1 45351.JGI87375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]