SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI8835 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI8835
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.00000000000000432
Family Pancreatic carboxypeptidases 0.00033
Further Details:      
 
Weak hits

Sequence:  45351.JGI8835
Domain Number - Region: 66-86
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00785
Family Carboxypeptidase regulatory domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI8835
Sequence length 86
Comment (Nematostella vectensis)
Sequence
IDGITNGARWYSISGGMQDYNYVHSNAFEITLELGCEKFPNASALPEYWDENKEALLGYI
EQTHRGVYGVVRDEEGDPIENARISI
Download sequence
Identical sequences A7TA71
45351.JGI8835 jgi|Nemve1|8835|gw.4636.2.1 XP_001619200.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]