SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 45351.JGI93135 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  45351.JGI93135
Domain Number 1 Region: 9-87
Classification Level Classification E-value
Superfamily RING/U-box 4.95e-17
Family RING finger domain, C3HC4 0.0067
Further Details:      
 
Domain Number 2 Region: 159-196
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000839
Family B-box zinc-binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 45351.JGI93135
Sequence length 197
Comment (Nematostella vectensis)
Sequence
MSSRSRTASLVRGLAEQLMCPVCLGEYKNPMLLRCYHSFCLRCVQELLHQSGEKGVVKCP
QCRTEMEVKRRLKSNFYINNLLDLMDETRLKAKARDPLVCCDHCQPLISAAEVKCVHCKV
SLCRACIGPHCEHMPTQPHTIKELATKAELEEELPAAREDFKTCAKHGLDLRFYCCTCEL
LMCRECLSVNHWNHEYM
Download sequence
Identical sequences A7RTP3
45351.JGI93135 jgi|Nemve1|93135|e_gw.32.192.1 XP_001637125.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]