SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 455632.SGR_1783 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455632.SGR_1783
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-46
Family Ribonuclease PH domain 1-like 0.000000128
Further Details:      
 
Domain Number 2 Region: 321-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.83e-41
Family Ribonuclease PH domain 1-like 0.000000258
Further Details:      
 
Domain Number 3 Region: 152-260
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.51e-29
Family Ribonuclease PH domain 2-like 0.00000128
Further Details:      
 
Domain Number 4 Region: 474-573
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.13e-23
Family Ribonuclease PH domain 2-like 0.00000874
Further Details:      
 
Domain Number 5 Region: 576-688
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.05e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 264-344
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.14e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 455632.SGR_1783
Sequence length 737
Comment (Streptomyces griseus NBRC 13350)
Sequence
MENETHYAEAVIDNGTFGTRTIRFETGRLAKQAAGSAVAYLDDDTMVLSATTASKRPKDN
LDFFPLTVDVEERQYAAGKIPGSFFRREGRPSEDAILTCRLIDRPLRPSFKKGLRNEIQI
VETIMALNPDHLYDVVAINAASCSTILAGLPFSGPIGATRVALIKGQWVAFPTHTELEDA
VFDMVVAGRVLEDGDVAIMMVEAEATEKTIQLVKDGAEAPTEEIVAAGLDAAKPFIKALC
KAQSDLASKAAKPVGEFPVFLDYQDDVFEALAKAVTSELKQALTIAGKQDREAELDRVKE
IAAEKLLPAFEGREKEISAAYRSLTKQLVRERVIKDKVRIDGRGVTDIRTLAAEVEAIPR
VHGSALFERGETQILGVTTLNMLRMEQQLDTLSPVTRKRYMHNYNFPPYSVGETGRVGSP
KRREIGHGALAERAIVPVLPTREEFPYAIRQVSEALGSNGSTSMGSVCASTMSLLNAGVP
LKAAVAGIAMGLISQEIDGKTHYVALTDILGAEDAFGDMDFKVAGTKQFVTALQLDTKLD
GIPASVLAAALKQARDARLHILDVMNEAIDVPDEMSPNAPRIITVKIPVDKIGEVIGPKG
KMINQIQEDTGADITIEDDGTIYIGAQAGSQAEAARATINAIANPTMPEVGERYLGTVVK
TTTFGAFVSLMPGKDGLLHISQIRKLAGGKRVENVEDVLGVGAKVQVEIAEIDSRGKLSL
IPVIEGEEDEKKDDTDK
Download sequence
Identical sequences B1VXZ6 G0Q0B9
gi|182435576|ref|YP_001823295.1| 455632.SGR_1783 WP_003965854.1.20467 WP_003965854.1.29035 WP_003965854.1.51792 WP_003965854.1.58927 WP_003965854.1.60218 WP_003965854.1.6712 WP_003965854.1.9539 WP_003965854.1.97807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]