SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 455632.SGR_36t from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455632.SGR_36t
Domain Number 1 Region: 73-139
Classification Level Classification E-value
Superfamily PGBD-like 3.14e-21
Family Peptidoglycan binding domain, PGBD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 455632.SGR_36t
Sequence length 142
Comment (Streptomyces griseus NBRC 13350)
Sequence
MSMRSSARFRSTITGAAVCSALALGSVLAGPGTAVASAETGQNSTSVSAASCNVIYRVST
NYKGWTANYSWAWNINVAQGDTGDRVREIQCLLIFKGFGVGAVDGDFGPATRTAVVAFQK
NRGLDYDGIVGANTWRKLRVRD
Download sequence
Identical sequences A0A0X3S8E8 B1VKM0
gi|182433829|ref|YP_001821548.1| gi|182440894|ref|YP_001828613.1| WP_012377452.1.20467 WP_012377452.1.58927 WP_012377452.1.60218 WP_012377452.1.6712 455632.SGR_36t 455632.SGR_7103t

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]