SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 455632.SGR_4720 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  455632.SGR_4720
Domain Number - Region: 31-99
Classification Level Classification E-value
Superfamily t-snare proteins 0.0353
Family t-snare proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 455632.SGR_4720
Sequence length 113
Comment (Streptomyces griseus NBRC 13350)
Sequence
MTQSERNERQRLRPAPLLFEPSQATADPEHFFDLESVEDPRELLARATELTQAFRAATDR
SVEFQAMAAAQLADPRRFDRLTAADVAERAEWTEDYAKKMIEFGRSLLDAPGA
Download sequence
Identical sequences B1VW38 G0Q8C7
WP_003968962.1.29035 WP_003968962.1.51792 WP_003968962.1.58927 WP_003968962.1.6712 WP_003968962.1.9539 WP_003968962.1.97807 455632.SGR_4720 gi|182438513|ref|YP_001826232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]