SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb01g013620.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  4558.Sb01g013620.1
Domain Number - Region: 110-150
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0628
Family Pre-dockerin domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb01g013620.1
Sequence length 225
Comment (Sorghum bicolor)
Sequence
MVWSGAKRRDRQKERERATAKKMLPRRARDPAAGVLTILPAILLLAVAAAMAMAAAEEAL
PMPMEVYFTPAELARIAGYGEEPVSSVSVSGQLTCELCLRPGSQLLALDMPGAKVAVTCK
SDRTPSNQLDSFAFATTDEYGNFTIDLPPQLHATPDLEKACTVKVLQLPADSCRLRHRTG
DTYGLRLSSVEDGVRAYTAGVIRLQDSDTPSDHCVGVEHMSERRT
Download sequence
Identical sequences 4558.Sb01g013620.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]