SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb01g018300.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb01g018300.1
Domain Number 1 Region: 151-231
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 2 Region: 41-95
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000701
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 3 Region: 450-519
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000145
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 4 Region: 283-350
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 5 Region: 373-431
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000656
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb01g018300.1
Sequence length 543
Comment (Sorghum bicolor)
Sequence
MDYGKSRRSNSKKRTYSNSEDRKRKRLNSRHDDTSMSSEPVETIYRILCPVKKIGSVLGR
GGDVVKALREETKAKIRVADPIPGADERVIIIFNYQNQPELTDEAAETKFSDGLGNMKPH
CFAQDALLKIHDKIVADEIHDGVAHEEKSESADDVTARILVQGNQVGCLLGKGGSIIQQL
RSDTGAGIRVLPSEDLPQCALKSDELVQISGAPSLVRKALYEISTRLHQHPRKENRPLEE
IINASTQRKRESPILLQHENPMLPHLHSDHPPPIPLLDPYRSGLQYHVTETEEFSIRILC
ASELIGSVIGKSGANVKRVEQQTGARIKVQEIDKDASGESLIIVSSKEVPSEPISPAIEA
LILLHDKVSAPSEKRHSSTRLVVPSSKVGCILGEGGKVITEMRRRTGAEIRVYSKADKPK
YLSFDDELVQTAGQIHGREDYRGLTSATGFLSTIELRIPNSSLESIVGVGGVNLAEIRQI
SGARLRLHEAHAGSSESVVEIQGTLEEAKAAQSLLQGFISANSRSIQQQPQSSRMPLYPS
WGL
Download sequence
Identical sequences 4558.Sb01g018300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]