SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb01g028800.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb01g028800.1
Domain Number 1 Region: 320-390
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 141-225
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000108
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 3 Region: 43-104
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000604
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb01g028800.1
Sequence length 452
Comment (Sorghum bicolor)
Sequence
MAEPSAAAVTAADVGALASLPPLVAEEADAAAMEEAAAAAKRWPGWPGDSVFRLVVPVLK
VGSIIGRKGELIKRLVEETKARVRILEGPVGATERIVLVSGKEDPGLELPPAMDALMRVF
KRVIGITDGAAEGTQAAATPGVCAARLLVPGAQAINLIGKQGATIKAIQESTGATIRVIS
VDERERPFYVTDDERIIEIQGDTEKVLKALQAVSNHLRKFLVDHSVLPLFEKTNTTVSQD
RNGDGWSDMSHPSIGSAQVNQPPSVVDEYILPVKRESLYLEREPLVDHNIHRSGVSLYGR
DPALSTLRPSGIHGAGPLLTQITQTMQIPLTYAEDIIGVKGANIAYIRANSGAVVTIQES
LGSPDDITVEIKGTSSQVQAAQQLIQDSLAAHREPVRSSYVGAGLDSVYRSSYSQYGSST
YPSSSLPSYSSIDDVSRYPSSGLGGYGSSYRY
Download sequence
Identical sequences C5WRH2
jgi|Sorbi1|5049049|Sb01g028800 4558.Sb01g028800.1 XP_002467474.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]