SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb01g042850.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb01g042850.1
Domain Number 1 Region: 90-149
Classification Level Classification E-value
Superfamily HMG-box 0.0000000157
Family HMG-box 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb01g042850.1
Sequence length 204
Comment (Sorghum bicolor)
Sequence
MDMVSQSEHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLSYLSPRPPMVQPLSP
TDHPLGPFQCQGPCNDCRRNQPLPLASPTSTELSPRMPFVVKPPEKKHRLPSAYNRFMRE
EIQRIKAAKPDIPHREAFSMAAKNWAKCDPRCSTTASTATSNSAPEPRVVPTPQVTEARF
DLEDRAKEQVIESFDIFKQIERSI
Download sequence
Identical sequences C5NS03
jgi|Sorbi1|5049926|Sb01g042850 XP_002468276.1.57931 4558.Sb01g042850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]