SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb02g003795.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb02g003795.1
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily Ribosomal protein S16 7.59e-18
Family Ribosomal protein S16 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb02g003795.1
Sequence length 71
Comment (Sorghum bicolor)
Sequence
AIYRIVAIDVRSQREGRDLRKVRFYDPIKNQTCLNVPAILYFLEKGAQPTRTVYDILRKA
EFFKDKERTLS
Download sequence
Identical sequences jgi|Sorbi1|5032605|Sb02g003795 4558.Sb02g003795.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]