SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb02g003900.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb02g003900.1
Domain Number 1 Region: 406-578
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-47
Family Ribonuclease PH domain 1-like 0.0000335
Further Details:      
 
Domain Number 2 Region: 77-213
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.9e-40
Family Ribonuclease PH domain 1-like 0.0000532
Further Details:      
 
Domain Number 3 Region: 217-300
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.88e-23
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 4 Region: 560-663
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.5e-22
Family Ribonuclease PH domain 2-like 0.0002
Further Details:      
 
Domain Number 5 Region: 731-812
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.31e-16
Family Cold shock DNA-binding domain-like 0.0018
Further Details:      
 
Domain Number 6 Region: 672-758
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000308
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 7 Region: 296-356,397-435
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000366
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb02g003900.1
Sequence length 877
Comment (Sorghum bicolor)
Sequence
MLACPAALHLLLPAPPPPSHQHQHHHVAFPAPPLHASLPCSRRARRRAPRPRHGVARASA
AVAEEASSSGPAKFSVRIPVGDREILVETGHIGRQASASVMVTDGETILYCSVCLADTPN
DPADFFPLSVHYQERLSAAGRTSGGFFKREGKTKDHEVLVCRLIDRPLRPTMPKGFYYET
QILSWVFSYDGIHSPDCLAITAAGIAVALSEIPNKQTIAGVRIGLIDDQFVVNPTTEQME
NSELDLMMAGTDSAILMIEGYCDFLTEEKLLEAVEAGQVAIREICKAIDVLVQSCGKKKM
VDAISLPPPELYRHVEDISGDELVKALQIKGKIPRRKALSALEDKVISILSEQGYVSKDA
SSGVTESLADIVEDEDEDEIIVDGEVDEGDFPIKPLFAEVDVKLVFKEVSSKYLRRRIVE
GGRRSDGRSPWELRPINSQCGLLPRAHGSALFTRGETQSLAVVTLGGYQMAQRIDNLVDT
EDSKSFYLQYSFPPSCVGEVGRIGAPSRREIGHGMLAERALEPILPPEEDFPYTIRVEST
ITESNGSSSMASVCGGCLALQDAGVPIKFPVAGIAMGLVLDTQEFGGDGSPLILSDITGA
EDASGDMDLKIAGNESGISAFQMDIKVVGITLPVMEQALFQARDGRQHILNEMSKSSPPP
SKALSPYAPLIHVMKVKPNKVNLIIGSGGKTIKSIIEETGVDAIDTGDDGTVKITARDLS
SLEKSKTIIANLTMVPKVGEIYRNCEIKSIAPYGAFVEIAPGREGLCHISELSSGWLAKA
EDAFKVGDRIDVKLIEINDKGQLRLSSRALLPDADSESNSGSTKEKAPQKDDAIKMTSRR
PRRKRQSEPFGAENATIKTLEKSAAAPAGSKGSEVGK
Download sequence
Identical sequences jgi|Sorbi1|5050605|Sb02g003900 4558.Sb02g003900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]