SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb03g003856.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb03g003856.1
Domain Number 1 Region: 358-714
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-116
Family Motor proteins 0.000000706
Further Details:      
 
Domain Number 2 Region: 25-154
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.46e-25
Family Calponin-homology domain, CH-domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb03g003856.1
Sequence length 794
Comment (Sorghum bicolor)
Sequence
MAEPRRVSFRDGRLASRKAEEAALRRHQAAAWLQAMVGSFGLAPYPSEQEFVASLRNGIV
LCKAINKLQPGAVAKIITNAPCDSQPLTAFQYFENIRNFLVAVNKMKLPSFEASDLDKDS
LDAGTVGKIVDCVISLKSYHEWKQAGGANGPIKYMKSPLAVRSSQLQSENVALGPSPSQK
RLDLTEADADTQPFQNVDPNMKDCAFAEAVEKLKKVIVDSMLSYKENFDQDILKKDPTKL
IGAVLANQLGKEQFKHLQLLSPEKLITENAPTHCIEHSSSQIENKQLLLQAHETELLDLK
KMFQDVKVNFRSLQTQFLDDMAKLGENIQDLSKAALGYNQAVKENRNLYNMLQELRGNIR
VFCRIRPLLNSESISSIEHVGSDGSVMVYDPVKPQSARKIFQFNKVFGPTTTQDEVYKET
QPFVRSVMDGYNVCIFAYGQTGSGKTHTMCGPSGGLSKDFGINYMALNDLFNISTSREDV
KYDIRVQMVEIYNEQVRDLLNEDRSSTKLDIRASLNNGLLNLPDAKIYPVQSPSDVINLM
QLGEKHRASGSTAINHRSSRSHSILTVHVNGKDIAGNVSRSSLHLVDLAGSERIDRSEAT
GDRLKEAQHINKSLSCLGDVINALAQKNSHIPYRNSKLTQLLQSSLGGNAKTLMFAHISP
EAESCAETLSTLKFAQRASTVELGTAHANKESSEIRELKEQVDTLKKALANKELEKSSLK
LKENATTSERTKQVLDRTPPRPRRLSLENASSGKAKMPERKILKSPRSAMGITHDKECNS
DGFRHTSHHESLLQ
Download sequence
Identical sequences 4558.Sb03g003856.1 jgi|Sorbi1|5035130|Sb03g003856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]