SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb03g016946.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  4558.Sb03g016946.1
Domain Number - Region: 12-47
Classification Level Classification E-value
Superfamily RNase III domain-like 0.00204
Family RNase III catalytic domain-like 0.033
Further Details:      
 
Domain Number - Region: 62-83
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0497
Family Chicken cartilage matrix protein 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb03g016946.1
Sequence length 99
Comment (Sorghum bicolor)
Sequence
VCSECPSFHGICNKHVGQLSSRRQEMICNATHYRLGIEHRIHGYIRNAAFDPCRRLAPGQ
LSSRPCPCEWLVKSEVVTEDIHEIDDKSIIIVKACDRFT
Download sequence
Identical sequences jgi|Sorbi1|5035838|Sb03g016946 4558.Sb03g016946.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]