SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb03g025580.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb03g025580.1
Domain Number 1 Region: 26-245
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.34e-41
Family DnaQ-like 3'-5' exonuclease 0.0016
Further Details:      
 
Domain Number 2 Region: 274-337
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb03g025580.1
Sequence length 340
Comment (Sorghum bicolor)
Sequence
MASHHSEPLDSAAAADAPSDNNPELPCPPYHIVTKPGQLPVEFLEPSAAQKLVIGFDCEG
VDLCRNGALCIMQLAFPDAVYLVDAIEGGKELIQACKPALESDHITKVIHDCKRDSEALY
FQFGIKLHNVMDTQIAYSLIQEQEQEGKKKTSDDYNYISFVSLLADKRFCGIPYPEKEEV
RTLLRQDPNFWTIRPLSDMMVRAATDDVRFLLNIYEKMMEKLSKVSLWRLAVRSELYCRC
FCLNDNQFADWSPLPPVPDDIEADVYVPEVDILSVLDVPPGKMGRVIGRKGSTIMAVKES
CNVEIHIGGAKGPPDRVFIIGPVKEVRKAEAIFRGRMLEF
Download sequence
Identical sequences C5XNP3
jgi|Sorbi1|5053207|Sb03g025580 XP_002458019.1.57931 4558.Sb03g025580.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]