SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb03g030230.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb03g030230.1
Domain Number 1 Region: 69-162
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.02e-22
Family Cold shock DNA-binding domain-like 0.00095
Further Details:      
 
Domain Number 2 Region: 157-237
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00077
Further Details:      
 
Domain Number 3 Region: 10-69
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 4.18e-17
Family ECR1 N-terminal domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb03g030230.1
Sequence length 239
Comment (Sorghum bicolor)
Sequence
MESRKPAPSPLVDNYVVPGDVVLDLSEMNNQTIKLGAGLRQECDTIQATSAGKLRLLKPN
KYWIENSQKRYIPSVEDTVLGIVVDTKPDNFLVDIKGPNLAFLPVLAFEGGTRRNIPKFE
IGTLIYARVVKANSIMNPELSCMDASGKAAEFGQLKDGYMFDTSTGMSRMLLSSPTCPVL
EALGKKLSFEIAVGLNGRVWVNAPAASTVILVSNAIMRSESLSGIKQRAMVENLLERLS
Download sequence
Identical sequences C5XFW6
jgi|Sorbi1|5053463|Sb03g030230 4558.Sb03g030230.1 XP_002456088.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]