SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb03g032910.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  4558.Sb03g032910.1
Domain Number - Region: 11-45
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0353
Family Zn-finger domain of Sec23/24 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb03g032910.1
Sequence length 237
Comment (Sorghum bicolor)
Sequence
METRLFLALQCVQCATMQVKQQKKSSNKWVCVVCNQRQSVLHVHARGYRAADLRRFVQDA
NLARGRREFAPLAEPDVDWDPAAVEEEGDVFPFPIEKRQTEWSEYLDDAGEPGNGCGGLG
ADASDGESGEGIEVITELPQKRPKVRPLKAQSDVVGKRTKLSTHPTLYNKRQQIKQGSSP
HCATATAEVQRSKSSLFGERKGSDTYGLHWTEHDESASTEATTDVVVEDEVHPDFIS
Download sequence
Identical sequences 4558.Sb03g032910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]