SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb06g025810.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb06g025810.1
Domain Number 1 Region: 186-312
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000398
Further Details:      
 
Domain Number 2 Region: 425-524
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.1e-28
Family Canonical RBD 0.00078
Further Details:      
 
Domain Number 3 Region: 304-350
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000009
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb06g025810.1
Sequence length 727
Comment (Sorghum bicolor)
Sequence
MASAETLTRSPSREPSSDPPRAASSEPHHNGDGTGAGAGKSSRRRRRSRWEQSNDDSAAN
NSGGEGGTGGRKRKTRWAEEEPRPAIALPDFMKDFAAEMDPEVHALNARLLEISRLLQSG
LPLDDRPEGARSPSPEPVYDNLGIRINTREYRARERLNRERQEIISQLIRRNPTFKPPSD
YRPPKLQKKLYIPMKEYPGYNFIGLIIGPRGNTQKRMEKETGAKIVIRGKGSVKEGKLLQ
KRDLKPDPSENEDLHVLVEADTQEALDAAAGMVEKLLTPVDEVLNEHKRQQLRELAALNG
TIRDDEFCRTCGEAGHRQYACPNKMNTFKSDVQCKICGDGGHPTIDCPVKGTSGKKMDDE
YQNFLAELGGGSAPESMNKSGGPMLALTGSGGSGGASAGTGSNPPWPWSTGGGVAATGLN
GIKKDYDETNLYIGYLPPTMDDPGLISLFSQFGDIVMAKVIKDRNTGQSKGYGFVKYSDV
SQANAAIAAMNGHHLEGRVIAVRVAGKPPQPAPAVSAPPSYPPPPTDPTSGGYSSQSYMR
APPPPPPGSYAPVPWGQPPPYASYPPPPPGSSVYNPAPPAPGQAAPPPYGVQYPPPPPPP
AAPIPPPGTTPSSDGAQNYPPGVAPPSSGTPTHPVATSVYASSGAPNAPSMYPPPPYSYS
PYYPPPFQPPPPPPPVSVDPSQSIATAPWATHSAVPPPPPPLSSSTDQPTASYGADAEYD
KFMSEMK
Download sequence
Identical sequences jgi|Sorbi1|5057708|Sb06g025810 4558.Sb06g025810.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]