SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4558.Sb06g030360.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb06g030360.1
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.95e-41
Family Calponin-homology domain, CH-domain 0.0000399
Further Details:      
 
Domain Number 2 Region: 186-245
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 9.15e-20
Family EB1 dimerisation domain-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb06g030360.1
Sequence length 269
Comment (Sorghum bicolor)
Sequence
MAAAVASIGIMDGAYFVGRGEILHWINATLQLSLAKVEEAASGAVQCQLMDMVHPGVVPM
HKVNFDAKTEYDMIQNYKVLQDVFNKLRIGKNIEVNKLVKGRPLDNLEFLQWLKRYCDSV
NGGIMNENYSPVERRSKGCKERGSKGSNKTSKSLQANRLPGADSADGGPGVGKVCNTFSE
EHYIEQIQKLSEKIADLKVSVDSIEKERDFYFSKLRDIEILCQRPELEHLPMTKAVRKIL
YAADAKDSPLPEANDIITKSPSLFSTETE
Download sequence
Identical sequences C5Y8Z5
4558.Sb06g030360.1 jgi|Sorbi1|5057983|Sb06g030360 XP_002447202.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]