SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_0212 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456442.Mboo_0212
Domain Number 1 Region: 38-270
Classification Level Classification E-value
Superfamily AF0104/ALDC/Ptd012-like 7.85e-74
Family Alpha-acetolactate decarboxylase-like 0.0000581
Further Details:      
 
Weak hits

Sequence:  456442.Mboo_0212
Domain Number - Region: 5-39
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.0667
Family F1F0 ATP synthase subunit C 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_0212
Sequence length 271
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MNKNFFLGIGLAVAIVFAGAAVYLGLAKQAPVNSADRDTLYQVSTISALMQGVYNGTTPV
GDLKKHGDFGIGTFDRLDGEMIVLDGKVWQAKADGTVSPATDDQTTPFATVTYFSPDFRQ
ATPDQAVNFSRFSAEMAARLPTQNMIYAVEIHGTFPSMTVRAIPAQEMPYPNLTVASAGE
HEYTFNNITGTVVGFYTPVFLKDLNTQGYHLHFLSDDHTRGGHILDMTVPAASSVEYDIT
PYYTVVLPTTGAFAGTNLTADMSGAVAAVER
Download sequence
Identical sequences A7I4S3
gi|154149759|ref|YP_001403377.1| WP_011991222.1.2930 456442.Mboo_0212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]