SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_1529 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456442.Mboo_1529
Domain Number 1 Region: 15-75
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000202
Family HSP20 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_1529
Sequence length 92
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MMGTKKPQKKKKPVIDPPAGISKNGKDTCVVCQLPGVPEESIRIYLDRTRLVISASGKDG
DIIKKIEVPEGSRISSKKYRDCILELILEEPG
Download sequence
Identical sequences A7I8I6
gi|154151072|ref|YP_001404690.1| 456442.Mboo_1529 WP_012107087.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]