SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_1650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  456442.Mboo_1650
Domain Number - Region: 42-98
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.0575
Family Small-conductance potassium channel 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_1650
Sequence length 153
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MKKNIFYLMTGLVAVVLLAIFWYSVENFTPLFFTIAFVAGIVLLYLAYRKVEDFIEDERS
ARITEKAATRTLQVFWVCFCAFSILAVMNLLDMPRFSRAFWLNRGTAVVPPEVLPLKLIG
YFQLALLCLMIFLYVGFRIYYARKFGDWESDEE
Download sequence
Identical sequences A7I8V6
gi|154151192|ref|YP_001404810.1| 456442.Mboo_1650 WP_012107213.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]