SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_2051 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456442.Mboo_2051
Domain Number 1 Region: 4-166
Classification Level Classification E-value
Superfamily FwdE-like 6.8e-48
Family FwdE-like 0.00096
Further Details:      
 
Weak hits

Sequence:  456442.Mboo_2051
Domain Number - Region: 170-200
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00732
Family RecO C-terminal domain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_2051
Sequence length 204
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MTCTFQSYEDAVAFHGHTCPGLALGYRAATHALVTLHAGRSSDEDLVAIVENDACGVDAV
QAIAGCSVGKGNLILRDLGKHAYTFINRKTGSAIRLVQRPEPLTERLDPGASALRTKVMA
GKATPTEEKEFHERQAALIKKILTIPIGELFIEKEARSEIPEHARISASVQCASCGETVA
EHRARVKSGKVVCIPCAGEYSRSG
Download sequence
Identical sequences A7IA04
456442.Mboo_2051 gi|154151590|ref|YP_001405208.1| WP_012107621.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]