SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_2457 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456442.Mboo_2457
Domain Number 1 Region: 84-165
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.00047
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000253
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_2457
Sequence length 181
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MIQELKIATSRVGVLIGKGGSTKKELEEKTHTTISIDSKEGLVKVEAAEENAIPLLRAVE
IINALNAGFSPQRAFEMIEDEDLLLDIIDLSRVADNPRQLDRLRGRIIGKDGRAREQIEN
MTDVDISVFGHTVGLIGYPEQMKIARAAIDMLIEGVPHENVFAFLDKKKKEAKQDMISYY
Y
Download sequence
Identical sequences A7IB60
WP_012108035.1.2930 gi|154151996|ref|YP_001405614.1| 456442.Mboo_2457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]