SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 456481.LEPBI_I2727 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456481.LEPBI_I2727
Domain Number 1 Region: 60-132
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000000000693
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 456481.LEPBI_I2727
Sequence length 191
Comment (Leptospira biflexa serovar Patoc Patoc 1 Paris )
Sequence
MVRILSPVFCFSLLLCLSCAKQRVEVGNKDLSEDQNHFLLFQGERFTGILVAENTILAET
YETEYYKGVPHGSYTVKTFGGVVLETRTVRYGQKHGSHQLYFPNGKLRQSSEFENGIPVG
EHIEYFDNGEMSTYQTFFPSGKPKVVKKWNKRGQIYLNHVFLESGESFGKPGSKLCEPVP
ENNVEENGTKL
Download sequence
Identical sequences B0SMT1
gi|189912149|ref|YP_001963704.1| 355278.LBF_2643 456481.LEPBI_I2727 WP_012389665.1.33202 WP_012389665.1.95533 gi|183222085|ref|YP_001840081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]