SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 457570.Nther_0484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  457570.Nther_0484
Domain Number 1 Region: 41-84
Classification Level Classification E-value
Superfamily LysM domain 0.00000000000123
Family LysM domain 0.0068
Further Details:      
 
Weak hits

Sequence:  457570.Nther_0484
Domain Number - Region: 205-226
Classification Level Classification E-value
Superfamily WW domain 0.0118
Family WW domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 457570.Nther_0484
Sequence length 241
Comment (Natranaerobius thermophilus JW NM WN LF)
Sequence
MLTKGGIRLLRVSKVLVVCLLVSGLLFTSLGGGQVQAASETHTVSSGETLWRISQWYDVS
LEDLRSVNNIWHNYIYPGQTLTIPSGQETETKESSNEIQETETEGSNSESQDTESESSWR
RLDISSYERDLIARIVYSEARGEPYEGQVAVASVVINRVLDNRWPNNVEGVIFEPLAFTP
VHNGQFWLTPNQTAYDAVEDALKGWDPSDGATFFYNPITATSSWIFTRTTIKQIGSHVFA
Y
Download sequence
Identical sequences B2A669
WP_012446967.1.10671 457570.Nther_0484 gi|188585123|ref|YP_001916668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]