SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 457570.Nther_1450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  457570.Nther_1450
Domain Number 1 Region: 6-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-49
Family Ribonuclease PH domain 1-like 0.0000219
Further Details:      
 
Domain Number 2 Region: 298-494
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-47
Family Ribonuclease PH domain 1-like 0.00000717
Further Details:      
 
Domain Number 3 Region: 143-232
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.16e-30
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 4 Region: 457-556
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.19e-28
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 614-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-22
Family Cold shock DNA-binding domain-like 0.00057
Further Details:      
 
Domain Number 6 Region: 559-636
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 457570.Nther_1450
Sequence length 718
Comment (Natranaerobius thermophilus JW NM WN LF)
Sequence
MPTTVSEEIAGYQLTLETGELAKQANGAVKVQYGNTVVLVTATASKEPKDDLNFFPLTVD
YEERLYAVGKIPGGFIKREGKPTEKATLTARLTDRPIRPLFPDGFRNPVHIVSTVLSVDQ
NCPPEIASIIGASAALSISDIPFDGPIASVKVGKVNDEIVVTPDVDEHEESQLDLVVAGT
KDAIMMVEAEANELPEDEMLEAIMKAHEEIKKIITMQEQLVEQVGQKKMEVELDLPSDEL
VSEVEELALEDIEKVLQIKDKLEREDAMDEAKQKVVDHLLEKYNSEENEDEEEELKEKHI
KSAFDSILKREMRSRIIHENSRPDGRGQKEIRPVTCDVDLLPNTHGSGLFTRGQTQVLNV
CTLGALGDVQILDGLDIEESKRYMHHYNFPPYSVGEAGFMKGPGRREIGHGALAERALKP
MIPTEKDFPYTIRLVSEVLESNGSTSMGSVCASSLSLMDAGVPIEKAVSGIAMGLIKEGD
QLAILSDIQGIEDFLGDMDFKVAGTEDGITALQMDIKISGTTREILKQALKQGKDGYLHI
LNIMKQTISEPREELSPLAPRVIKKQIDPDKIRNVIGPGGKMINKIIDETGVKIDIEPDG
LIYISSSDAEQAEQAIKAIDELIKEPEVGEVYLGKVVRTEKYGAFVEILPGKEGLVHISE
LAEDRVGKTEDVAKVGDEILVKIINIDERGRINLSRKQALGEEDGKTNNDDKKSTKKT
Download sequence
Identical sequences B2A3A3
gi|188586076|ref|YP_001917621.1| WP_012447907.1.10671 457570.Nther_1450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]