SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 457570.Nther_1475 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  457570.Nther_1475
Domain Number 1 Region: 281-438
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.37e-31
Family HD domain 0.018
Further Details:      
 
Domain Number 2 Region: 175-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Weak hits

Sequence:  457570.Nther_1475
Domain Number - Region: 21-108
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00118
Family HBL-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 457570.Nther_1475
Sequence length 487
Comment (Natranaerobius thermophilus JW NM WN LF)
Sequence
MIAEAKITSAEEAADKIIEDAKKQGESMKREALLEAKEEIHTQRNELEKETRERRNEIQR
FERKLEQKEESLSKQQKQLEQKEKEIAQKDEKITNKEQELEKIYQQQVEELENLSGLTTQ
EAKDMLLNRVREDISHETAMMIKEMESRAKEEADKKAREIITTAIQRCAVDHVAESTVSV
VSLPNDEMKGRIIGREGRNIRTLETLTGIDLIIDDTPEAVILSGFDPIRREIARLALEKL
VSDGRIHPARIEEMVEKAQKEVDEQIREEGEQATLDTGVHGLHSELIKLLGRLKFRTSYG
QNVLNHSIEVARLCGVMAHELGTDVNTAKRAGLLHDIGKAVDHEYEGPHVTIGAELGKKY
GESSNVLHAIATHHGDEEPETIEAVLVQAADAISAARPGARRETLESYIKRLEKLEEIAD
SYKSVEKAYAIQAGREVRIMVKPEQADDETSINLARDISKQIEAELDYPGQIKITVIRET
RAVEYAK
Download sequence
Identical sequences B2A3V6
457570.Nther_1475 gi|188586101|ref|YP_001917646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]