SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 457570.Nther_2939 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  457570.Nther_2939
Domain Number - Region: 4-53
Classification Level Classification E-value
Superfamily OmpH-like 0.0785
Family OmpH-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 457570.Nther_2939
Sequence length 153
Comment (Natranaerobius thermophilus JW NM WN LF)
Sequence
MKIIKEKAELYKQSREEVNRKIEVWENEIFDLVENKLQEIVSEIGSIEGLKVTVGESPMA
RSVRLTFGVGPYGKVDDEAFIKRGGSLLFIPKLNGGILVSTSSPSIESDERILVEEEKKP
LENYNDPNKITEDKVEKHVEEFFDDLINWWDTL
Download sequence
Identical sequences B2A8N5
WP_012443510.1.10671 457570.Nther_2939 gi|188584630|ref|YP_001911145.1|NC_010715 gi|188584630|ref|YP_001911145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]