SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 465817.ETA_20160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  465817.ETA_20160
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.93e-48
Family Extended AAA-ATPase domain 0.000000175
Further Details:      
 
Domain Number 2 Region: 209-323
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 6.12e-28
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 465817.ETA_20160
Sequence length 334
Comment (Erwinia tasmaniensis)
Sequence
MNWYPWLNHSYKQIIAQHVAQRGHHALLIQALPGMGDDALIWGIGRWLMCRQPEGLKSCG
KCHACELMQAGTHPDWYRLEAEKGKNALGIDAVRSVTEKLYHHAQQGGAKVVWLPDAQQL
TEAAANALLKTLEEPPKNTWFLLSSREPSRLLPTLRSRCLLWHLPPPDEAQSLQWLQKHC
SASLNERSAALRLSAGAPAAALALLEEKNWQQRLRVCQALPAALSGDIMSLLAVFNYDDV
ARRIGWLCSLLVDAAKWQQGGGQFIGNIDQQALVIHLASLLPTSALDASLRQWVVCRDRL
LTVVAVNRELLLTEQLLSWETIIKPVFSGSELKE
Download sequence
Identical sequences B2VDK2
465817.ETA_20160 WP_012441740.1.58220 gi|188534148|ref|YP_001907945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]