SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 467705.SGO_0593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  467705.SGO_0593
Domain Number 1 Region: 340-488
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.86e-28
Family HD domain 0.031
Further Details:      
 
Domain Number 2 Region: 225-319
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000114
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 467705.SGO_0593
Sequence length 535
Comment (Streptococcus gordonii Challis substr CH1)
Sequence
MEMIFALVFAVIIGLVIGYVSISARMKSSKEAAELTLLNAEQEATNLRGQAEREADIILK
DAKRETNSLKKEALLEAKEEARKYREEVEAEFKSERQELKQTESRLTERAASLDRKDDNL
TNKEKLLEQKEQSLSDKTKYIDEREEQLAELEKQKEAELERVASLSQNEARDLILAQTEE
KLTKEIAMRIREAEQEVKERSDKMAKDILVQAMQRIAGDYVAEQTNSTVHLPDDTMKGRI
IGREGRNIRTFESLTGIDVIIDDTPDVVTLSGFDPVRREIARMTMEALLKDGRIHPARIE
ELVEKNRLEIDNRIREYGEAAAYEIGAPNLHPDLMKIMGRLQFRTSYGQNVLRHSIEVAK
LAGVIAGELGENATLARRAGFLHDIGKAIDREVEGSHVEIGTELARKYKENPIVVNTIAS
HHGDVEAESVIAVIVAAADALSAARPGARSESLESYIKRLHDLEEIANEFDGVKTSFALQ
AGREIRIMVHPEKIKDDKVTILAHDVREKIENNLEYPGNIKVTVIRELRAVDYAK
Download sequence
Identical sequences A0A0F2CD82 A8AVU9 D0RTG1
467705.SGO_0593 WP_008808587.1.24227 WP_008808587.1.24863 WP_008808587.1.30989 WP_008808587.1.45496 WP_008808587.1.50634 WP_008808587.1.50638 WP_008808587.1.63372 WP_008808587.1.70293 WP_008808587.1.97211 gi|157150832|ref|YP_001449909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]