SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 469378.Ccur_07460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  469378.Ccur_07460
Domain Number 1 Region: 325-476
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.11e-32
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 218-309
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000654
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 469378.Ccur_07460
Sequence length 525
Comment (Cryptobacterium curtum DSM 15641)
Sequence
MSEIILIVAIVIAIAAIVAVIVMRQSTQKSQHRSEEEARTLLEDARRQADALRREAEIEA
KDEALKLRQSVELEKADRLKEVRAAEDRLNQREKSLDHRSDSLDAREHQLSSMQGQVEKR
NRDLQESERELQQRRDNLDEEYEQVNRKLESVAGMTADEAKDELLNNLKDGLAHESAAII
RESEARTKAEADKTAREILSLAIQRVAADHAAEVTVSTIHIPSDELKGRIIGREGRNIRS
FEQLTGTNLIIDDTPECVTISCFDPVRREIGRVTMENLVADGRIHPARIEEMFKKAEKLV
DQRVQEAGEQAAFDTGMHDLHPELVHTLGRLRYRTSYGQNVLNHSLEVAYIAGVIASELG
IDPITAKRAGLLHDIGKAVDHEVEGGHAVIGADLARRFGERPEIVHAIEAHHNDVEPNSV
LDVIIQAADAVSAARPGARKETLDAYVKRLEKLEEIANAHKGVERTYAIQAGREVRVMVK
PEEVDEAATTVLAHDIAQQIENEMQYPGQVKVVVIRESRAVDIAK
Download sequence
Identical sequences C7MNG2
gi|256827175|ref|YP_003151134.1| WP_012803140.1.80809 469378.Ccur_07460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]