SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 469378.Ccur_07600 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  469378.Ccur_07600
Domain Number 1 Region: 294-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-47
Family Ribonuclease PH domain 1-like 0.00000447
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.66e-39
Family Ribonuclease PH domain 1-like 0.0000447
Further Details:      
 
Domain Number 3 Region: 450-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.88e-25
Family Ribonuclease PH domain 2-like 0.00017
Further Details:      
 
Domain Number 4 Region: 143-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-22
Family Ribonuclease PH domain 2-like 0.0024
Further Details:      
 
Domain Number 5 Region: 554-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.31e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 6 Region: 620-689
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.82e-17
Family Cold shock DNA-binding domain-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 469378.Ccur_07600
Sequence length 742
Comment (Cryptobacterium curtum DSM 15641)
Sequence
MKKVVEEFELYGKSYRLETGELAKQATGAVLVTQGETTCLVTAVVSKEEKDYDFFPLTVD
FMEKMYAVGRIPGGYLKREGKASDKGTLTARMIDRPIRPGFPDGFKQEVHIVATTFVADG
QNPPDCICVGGASAALLAGGAPFDGPAACVRIARNVETGEFIVNPTYAEQEESDLELTIA
GTADYISMVEAGANEVSEEDMLAAMNFGQEAIAAFCDAQQRFLDQLDCTPLEYAIHTADP
RIAERVNAHEAEMAAALRDADKLSRIAKVEALKAAVRESDFSDEERAAWASDIAAALKAL
EKRAMRVMIIETGERVDGRAADEIRPLYIRPGYLPRVHGSGLFQRGQTQALSVCTLGTLR
EGQRLDTIDPSEGKRYMHQYNFPPYCTGEVGRIGAPKRREIGHGALAERALIPVLPSEDD
FPYAIRVVSEILESNGSSSMASTCGSTLALMDAGVPITAPVSGIAMGLIKEGDETVILSD
IQGLEDFLGDMDFKVTGTARGITALQMDNKARGLSTEILGRALAQAKEGRAFILSAMLEQ
ISEPRAELSEFAPRIETIKIPVEKIRDVIGTGGKVIRGLQDETGATIEVEEDGTVHIAAV
EGPAGEAAKQAILDIIKEPEVGEIYDGEVVGIKDFGAFVKLTAGKDGLLHISRMANGRVG
QVEDVLNLGDAVKVEVIEVGDNGKISLDRIDKPDAPQGSSRPRRDIDSRSDRGQHERRQS
GRRPGDQGVQGDHRRSRSRKRD
Download sequence
Identical sequences C7MNH4
gi|256827187|ref|YP_003151146.1| 469378.Ccur_07600 WP_012803152.1.80809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]