SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471223.GWCH70_1161 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471223.GWCH70_1161
Domain Number 1 Region: 292-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.94e-52
Family Ribonuclease PH domain 1-like 0.00000889
Further Details:      
 
Domain Number 2 Region: 8-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.39e-50
Family Ribonuclease PH domain 1-like 0.0000198
Further Details:      
 
Domain Number 3 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.4e-30
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 145-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.01e-30
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.71e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 6 Region: 621-701
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2e-21
Family Cold shock DNA-binding domain-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 471223.GWCH70_1161
Sequence length 712
Comment (Geobacillus WCH70)
Sequence
MEQEKRIFSIDWAGRPLVVEIGQLAKQANGAVLVRYGDTVVLNTATASKEAKNVDFFPLT
VNYEERLYAVGKIPGGFIKREGRPSEKAILASRLIDRPIRPLFAEGFRNEVQIVSMVMSV
DQDCSPEMAALFGASLALTISDIPFEGPIAGVTVGRVDGEFVINPTVEQSEKSDIHLVVA
GTKDAINMVEAGADEVPEEVILEAIMFGHEEVKRLIAFQEEIAAQVGKEKMEVVLYELDP
QLEAEIRQLAEEDIKRAVQVPEKLARDAAIEEVKASVIAKYEEQEADEETLKQVNEILHK
LVKEEVRRLITEEKIRPDGRKIDEIRPLSSEVGVLPRTHGSGLFTRGQTQVLSVCTLGAL
GDVQILDGLGIEETKRFMHHYNFPPFSVGETGPMRGPGRREIGHGALGERALEPVVPSEK
EFPYTIRLVSEVLESNGSTSQASICASTLAMMDAGVPIKAPVAGIAMGLVKNDDNYTILT
DIQGIEDHLGDMDFKVAGTAKGVTALQMDIKIKGLSREILEEALQQAKKGRMEILEHMMQ
TIREPRKELSKYAPKILTMQINPEKIREVIGPSGKQINKIIDETGVKIDIEQDGTIFISS
VNEAMNQKAKQIIEDIVREVEVGQIYLGKVKRIEKFGAFVELFNGKDGLVHISELAEERV
GRVEDVVSIGDEILVKVMEIDKQGRVNLSRKAVLRDKKEKKGKRPERHRMKP
Download sequence
Identical sequences C5D9D5
gi|239826663|ref|YP_002949287.1| 471223.GWCH70_1161 WP_015863493.1.59651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]