SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471223.GWCH70_1191 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471223.GWCH70_1191
Domain Number 1 Region: 314-465
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.77e-31
Family HD domain 0.013
Further Details:      
 
Domain Number 2 Region: 206-302
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.04e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 471223.GWCH70_1191
Sequence length 518
Comment (Geobacillus WCH70)
Sequence
MGSIIISALLALVVGAVVGFFIRKSIAEAKIGGAQAAANQIIEDAKREADALKKEALLEA
KDEIHKLRTEVEREIRDRRSELQKQENRLLQKEENLDRKDEALNKREALLESKEEALNQR
QQHIEQMESKVEELVQKEQMELERISGLTREEARQVILERVEKELSHEIAMMVKEAETRA
KEEADKRAKAILSLAIQRCAADHVAETTVSVVNLPNDEMKGRIIGREGRNIRTLETLTGI
DLIIDDTPEAVILSGFDPIRRETARIALDKLVQDGRIHPARIEEMVEKARREVDEHIREV
GEQTTFEVGVHGLHPDLIKILGRLKFRTSYGQNVLKHSIEVAFLAGLMAAELGEDEMLAR
RAGLLHDIGKAIDHEVEGSHVEIGVELATKYKEHPVVINSIASHHGDTEPTSVIAVLVAA
ADALSAARPGARSETLENYIRRLEKLEEIAESYEGVEKSYAIQAGREVRIMVKPDMIDDL
EAHRLAREIRKRIEEELDYPGHIKVTVIRETRAVEYAK
Download sequence
Identical sequences A0A150MYT2 A0A226QT43 A0A2A6AME4 C5D9G5
WP_015863523.1.25537 WP_015863523.1.33554 WP_015863523.1.48526 WP_015863523.1.59651 WP_015863523.1.67826 gi|239826693|ref|YP_002949317.1| 471223.GWCH70_1191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]