SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471821.TGRD_369 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471821.TGRD_369
Domain Number 1 Region: 7-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.57e-18
Family Extended AAA-ATPase domain 0.028
Further Details:      
 
Domain Number 2 Region: 219-338
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.67e-17
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471821.TGRD_369
Sequence length 339
Comment (uncultured Termite group 1 bacterium phylotype Rs D17)
Sequence
MNILKMHDFNKLISLQKISSVYLLAGEESYFINMCLNKIEKFTATDDLNRDVFYASESSA
DDILNALQTLPFLSEIRVVIVKGVNKMKAIDAERLTDYLSNTIETSCLILLYFDNYKKET
VAKRREFINKCIASKNCVSVNCRKQYENEVKEFIKNEFAQKGKEVSYDVISRIIEENGND
LLNISNEIEKLSLFAGKNKKDITQEDLEKISGYTKETGIYALSSEIEARDLKKTMFVLEK
LLNEREEPVIILSAISSVVRKMLNAKSMIEEQGLSTAEIASALRIHDFYAETFFTNLKKY
STDTLKESLKTILKTDTAIKTGSNDAASALEKTILSICK
Download sequence
Identical sequences B1H020
471821.TGRD_369 gi|189485372|ref|YP_001956313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]