SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471852.Tcur_3291 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471852.Tcur_3291
Domain Number 1 Region: 315-472
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.2e-24
Family HD domain 0.029
Further Details:      
 
Domain Number 2 Region: 210-300
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000323
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471852.Tcur_3291
Sequence length 523
Comment (Thermomonospora curvata DSM 43183)
Sequence
MVSVLLGTALLVTLGVLILVLRRQGVPPWQLQERLSAVRQEAEEIRARAQADAQEIVRKA
EEQAKKSAEAARAELESEARSLKEDLRSLREDLERRESRLAEREQRLDAEVRRLEEHGRR
LAETRRELEARKAELDRLDEDRRRVLEQAAGLTAEQAKNELIASIENQAKREAALITREI
ESAARAEGEKRARKIVTLAIQRVASEQTAESVVSVLHLPSEEMKGRIIGREGRNIRAFET
TTGVNLIIDDTPEAVLLSCFDPVRREVARLTLEKLVQDGRIHPQRIEEVYERSKADVERL
CVRAGEDALLELGITDMHPELIALLGQLRYRTSYGQNVLGHLVESAHIAGIMAAELRLPV
ELVKRCTLLHDIGKALTHEVEGSHALIGAEIARRYGEHEDVVHAIEAHHNEVEVRTVEAV
LTQAADAISGSRPGARRESLEAYVKRLERLEQIAREKHEGVEKVYAMQAGREIRVMVKPE
AVDDIQAQVIARDIAKQVEDELTYPGQIRVTVIRESRATEFAR
Download sequence
Identical sequences D1AAB7
gi|269127498|ref|YP_003300868.1| 471852.Tcur_3291 WP_012853614.1.83154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]