SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471854.Dfer_0007 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471854.Dfer_0007
Domain Number 1 Region: 309-473
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.04e-27
Family HD domain 0.037
Further Details:      
 
Domain Number 2 Region: 209-297
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000584
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471854.Dfer_0007
Sequence length 523
Comment (Dyadobacter fermentans DSM 18053)
Sequence
MSNSLFFIVILSDIIAVGVGIFAGKYIFQRSFDAKEKEAQDRAAEILRNAEVAAENIKKD
RILEAKEKYLRLKSEFEEDANKKRSILQSNEQKLKQREQSLNQSMEQTKRKENELDNLKN
NLNSQLEAATKRREEAEKSLQQQVAQLEKIANLTAEQAREQLVDALKAEAETRAGSYIKS
AMEEARLTATKEAKKIVIETIQRTAAEHAIENCVSVFNIENDDIKGKIIGREGRNIRALE
AATGVEIIVDDTPEAIVISGFDPVRREIARLSLHRLVQDGRIHPARIEEVVAKTRKNIED
EIVEIGERTVIDMGIHGLHPELVKMIGRMRFRSSYGQNLLQHSREVAKLCATMAAELGLN
TKLAKRAGLLHDIGKVWPEESDLPHAILGMELAKKYKENPEVCNAIGAHHDEIEMTSILS
PVIQVCDAISGSRPGARREMMESYIQRLRDLENLALSFDGVEKCYAIQAGRELRVIIDAD
NVSDEKAGLLSFDISQKIEKEMQYPGQIKITVIREMRSVAYAR
Download sequence
Identical sequences C6VUH0
gi|255033823|ref|YP_003084444.1| WP_012779627.1.10152 471854.Dfer_0007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]