SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471855.Shel_10740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471855.Shel_10740
Domain Number 1 Region: 312-463
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.39e-29
Family HD domain 0.016
Further Details:      
 
Domain Number 2 Region: 203-297
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000162
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 471855.Shel_10740
Sequence length 513
Comment (Slackia heliotrinireducens DSM 20476)
Sequence
MDYVIVILVLIVGIAAGVAIGLIVSRNMANSSTRRAADEAKRLIDDAERQADTLRREAVV
EAKDEVLKMKQEAQAENKERMREVRAAENRINQREESLDRRVESLDAREHQLSSMQGQVE
RRERDVAKAMEEVNVRLEEVAGMSPQEAKEELLDSLRDEVTHESAAIIRDAEQRTKAEAD
RNAREILSLAIQRVAADHTAETTVKTIHIPSDDLKGRIIGREGRNIRSFEQLTGVNLLID
DTPECVTISCFDPVRREIGRITMENLIADGRIHPARIEEMFSKAERLVNQQVQEAGEQAT
FDCGIHDLHPELVRTLGRLRYRTSYGQSVLNHSLEVAYLCGVMASELGLDPAPAKRAGLL
HDIGKAIDHEVEGPHALIGGDLARRFGERPEIVHAIEAHHNDIETNSVIDVLVQAADAVS
AARPGARKESLESYIKRLEKFEEIANAHPGVERTYAMQAGREIRVMVAPEQVDEAASVVL
AHDIAKQIEDEMQYPGQVKVVVIRESRAIDYAK
Download sequence
Identical sequences C7N5C4
WP_012798212.1.33174 471855.Shel_10740 gi|257063786|ref|YP_003143458.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]