SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471855.Shel_10960 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471855.Shel_10960
Domain Number 1 Region: 294-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-47
Family Ribonuclease PH domain 1-like 0.00000876
Further Details:      
 
Domain Number 2 Region: 7-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.63e-39
Family Ribonuclease PH domain 1-like 0.0000424
Further Details:      
 
Domain Number 3 Region: 450-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.06e-25
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 4 Region: 143-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.9e-23
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 
Domain Number 5 Region: 554-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.01e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 620-690
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.58e-20
Family Cold shock DNA-binding domain-like 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471855.Shel_10960
Sequence length 743
Comment (Slackia heliotrinireducens DSM 20476)
Sequence
MEKVSLAFELYGKEYAFETGELAKQATGAVLVKQGETTVLVTAVISAQEKDYDFFPLTVD
FMEKMYAVGRIPGGYLKREGKASDKGTLTARMIDRPIRPGFADGFKQEVHVVATTFAIDG
QNPPDCICVGGASAALMIGSAPFDGPAACVRIARNAETKEFIVNPTYEEQETSDLELTIA
GTRDYISMVEAGANEVTEEDMLAAMNFGQEAIAAFCEKQAEFLAMVAPEPREWPIHVPDA
SIAERVDAHFDEMSAALKDADKQSRIAKVEELKAAIKANDFSEEEQAAWGSDIAAALKSL
EKHAMRRMVIETGERADGRAADEIRPLYIRPGYLPRVHGSGLFQRGQTQALSVCTLGLLN
EAQRLDTIDPATGKRYMHQYNFPPYCTGEVGRMGAPKRREVGHGALAERAILPVLPSEDE
FPYAIRVVSEILESNGSSSMASTCGSCLALMDAGVPIKAPVSGIAMGLIKEEDGVVILSD
IQGLEDFLGDMDFKVTGTANGITALQMDNKARGLSTEILGRALQQAKEGRAHILNAMLAE
IPGPREELRDTAPRIETIHIPVDKIREVIGKGGETIRGIQDSTGASIEIQEDGTVHIASV
DQEAGRAAKAAVEAIVKEPEVGEVYEGTVVGIQTFGAFVKLTPSKDGLLHISRMANGRVS
KVEDVLNMGDTVKVQVIEIDPKSGKVSLDRLEKPDAPEGSEPAHNGREERGNGRDRRPGR
GNRNNGNEDRGGDNRKPRRRHQQ
Download sequence
Identical sequences C7N5E6
471855.Shel_10960 gi|257063808|ref|YP_003143480.1| WP_012798234.1.33174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]