SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471855.Shel_12960 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471855.Shel_12960
Domain Number 1 Region: 109-276
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.65e-40
Family Tandem AAA-ATPase domain 0.097
Further Details:      
 
Domain Number 2 Region: 16-58
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000231
Family Eukaryotic type KH-domain (KH-domain type I) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471855.Shel_12960
Sequence length 326
Comment (Slackia heliotrinireducens DSM 20476)
Sequence
MTNDTQITLTVPDHVDMASIVGPQDSVLHTIQKAYSARITVRGNTVTIKGDTLEVQSLAT
LFGDLIKVSGSGDVPTVDYVQHAIDLLRMGEFSPTALREDILLTYRGRAIRPKTAGQKRY
VDAIRDNTVTFAIGPAGTGKTYLAMAMAVAALKRKEVNRVILTRPIVEAGENLGFLPGTL
TEKVDPYIRPLYDALFDMTDAGAAADLLETGVIEIAPLAFMRGRTFNDSFIILDEAQNTS
PEQMKMFLTRLGFNSKMVVTGDVTQVDMPGGRSGLRHARAVLEHVDDIAFCDLSGKDVVR
HSLVARIVDAYEHAETTRSKKHTEGE
Download sequence
Identical sequences C7N5Y8
gi|257064000|ref|YP_003143672.1| 471855.Shel_12960 WP_012798425.1.33174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]