SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471856.Jden_1043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471856.Jden_1043
Domain Number 1 Region: 291-413
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.26e-28
Family HD domain 0.025
Further Details:      
 
Domain Number 2 Region: 184-257
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000167
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Weak hits

Sequence:  471856.Jden_1043
Domain Number - Region: 82-133
Classification Level Classification E-value
Superfamily LemA-like 0.0549
Family LemA-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 471856.Jden_1043
Sequence length 488
Comment (Jonesia denitrificans DSM 20603)
Sequence
MNLDESGFIVATLLIALIALLLVLAARRDAQVVRDNARTDADHLIASAERRDKESRDRES
RLDERERQLDEARDTIATEQRDIAEQRERLDRDRKEHQSQLSAQHRQLTAELERISGLTA
DQATLQLREQIAADNDAYVRTALRERELLTRTKADAQARRIIADAMSRLAVPVSTQIAQE
AVELPAPEFRGRIIGKEGRNIRTFEALTGVDVILDDDSSSVVLSSFDAERRDVAVTAMKE
LIADGRIHPGRIEEVVAGARESMSSRTLNVGYDAVKAAGVGPLPTELVATIGRLRFRTSY
AQNVLDHCVETALIAGAIADELGADAAVARRAGLLHDIGKLMTAAQPGSHAKLGAQLIRD
YGESEDVAHAVRAHHGEEEFRTVEAVIVQIADSISAARPGARRDDLSSYVERVTQLEDVV
TAHEGVAHAYVVSSGHEIRVVVEPERVTDDDLHVLAGTIADAVQQHTTFPGEVAITVIRE
TRATSRAG
Download sequence
Identical sequences C7R3G3
gi|256832275|ref|YP_003161002.1| WP_015771327.1.34072 WP_015771327.1.39474 471856.Jden_1043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]