SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471857.Svir_09460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  471857.Svir_09460
Domain Number - Region: 94-139
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0118
Family F1F0 ATP synthase subunit B, membrane domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471857.Svir_09460
Sequence length 229
Comment (Saccharomonospora viridis DSM 43017)
Sequence
MYRVFEALDELVTIVEEARGVPMTSSCVVPRGDVLELLDDIRDALPGEVDDAQDVLDKRD
EIIRMAQDQADEMVSSAKAEAERMMEEARAHAERILAEAKAEADRTIAEGEAEYAEVTER
ARTEADRMVQAGRDAYERAVEDGKREQARLVSQTEVVQAAHDEAARIIDEAHEEADRQRA
DCDAYVDGKLAEFSDLLATTLRTVDSGRNHLRSPLPSTARQAVYDYQAQ
Download sequence
Identical sequences A0A1I5SZ01 C7MY55
WP_012796432.1.37385 WP_012796432.1.67378 WP_012796432.1.81884 471857.Svir_09460 gi|257054998|ref|YP_003132830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]