SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 471857.Svir_12510 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  471857.Svir_12510
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 3.84e-31
Family Ribosomal L27 protein 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 471857.Svir_12510
Sequence length 85
Comment (Saccharomonospora viridis DSM 43017)
Sequence
MATKKGASNSRNGRDSNPKYLGVKRFGGQTVKAGEILVRQRGTKFHPGVNVGRGGDDTLF
ALAAGSVQFGTKRGRKTVNIVPVEA
Download sequence
Identical sequences A0A1I5LRH6 C7MPQ5
gi|257055295|ref|YP_003133127.1| 471857.Svir_12510 WP_015785615.1.37385 WP_015785615.1.67378 WP_015785615.1.81884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]