SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 478801.Ksed_21720 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  478801.Ksed_21720
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily L28p-like 2.31e-21
Family Ribosomal protein L31p 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 478801.Ksed_21720
Sequence length 82
Comment (Kytococcus sedentarius DSM 20547)
Sequence
MKKDIHPDDHPVVFRDADAGFAFLTRSTTTPSRTIEWEDGNVYPVVDVEVSSASHPFYTG
RQRAMDTAGRVERFRQPYGGRR
Download sequence
Identical sequences C7NLG3
478801.Ksed_21720 WP_015780094.1.81216 gi|256825964|ref|YP_003149924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]