SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479431.Namu_3136 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  479431.Namu_3136
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily Ribosomal protein S16 8.11e-32
Family Ribosomal protein S16 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 479431.Namu_3136
Sequence length 144
Comment (Nakamurella multipartita DSM 44233)
Sequence
MAVKIKLARFGKIREPHYRIVVADSRTRRAGRTIENIGLYQPKSEPSLIEVDSERVQYWL
GVGAQPTEPVLGLLKVTGDWQKFKGLPGAEGTLKPQPVKADKRALYEAAIAAIGGDADNS
ATTPRRKAKAAADEAPAAESTDAS
Download sequence
Identical sequences C8XBW5
WP_015748337.1.85990 479431.Namu_3136 gi|258653302|ref|YP_003202458.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]