SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 479431.Namu_3268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  479431.Namu_3268
Domain Number - Region: 25-48
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00543
Family GCC-box binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 479431.Namu_3268
Sequence length 67
Comment (Nakamurella multipartita DSM 44233)
Sequence
MGDEIGQSKGYYYNITTGQVEPEGQSKAKDLLGPFDTAEEAAQALDIIREREQRKEAEDA
QWRRGQG
Download sequence
Identical sequences C8XCZ6
479431.Namu_3268 WP_015748466.1.85990 gi|258653432|ref|YP_003202588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]